SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001954 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001954
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000392
Family Dystroglycan, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001954   Gene: ENSMMUG00000001466   Transcript: ENSMMUT00000002069
Sequence length 262
Comment pep:known_by_projection chromosome:MMUL_1:16:34402822:34414593:1 gene:ENSMMUG00000001466 transcript:ENSMMUT00000002069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTLFWTPLLEVLLAGLGDCEAQQTTLYPLVGRVFVHTLDHETFLSLPEHVAVPPAVHI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSAPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGTRVSLISSIQMVHHCTIHGNTEELRQMAANREVPRPLSTLPMFNV
RTGERLPPRVDSAQVPLILDQH
Download sequence
Identical sequences ENSMMUP00000001954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]