SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001959 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001959
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-18
Family Calponin-homology domain, CH-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001959   Gene: ENSMMUG00000001473   Transcript: ENSMMUT00000002075
Sequence length 291
Comment pep:known_by_projection chromosome:MMUL_1:19:11368700:11379799:1 gene:ENSMMUG00000001473 transcript:ENSMMUT00000002075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFSPRLKTSSLREVKTLTAPKLQEQIIGGWGGGHTGVPAQPEDCSDVKQCSSAVTHAGP
ESNSLASASHLWRSDTRVWDGPLWSSCHPAPAGLGWIGGVEMGTNKFASQQGMTAYGTRR
HLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQ
MGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
Download sequence
Identical sequences 9544.ENSMMUP00000001959 ENSMMUP00000001959 ENSMMUP00000001959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]