SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001968 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001968
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000167
Family Laminin-type module 0.00019
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000264
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 462-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.00095
Further Details:      
 
Domain Number 4 Region: 142-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 84-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000197
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001968
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 925-1168
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001968   Gene: ENSMMUG00000001479   Transcript: ENSMMUT00000002085
Sequence length 1193
Comment pep:known_by_projection chromosome:MMUL_1:1:187428508:187485794:-1 gene:ENSMMUG00000001479 transcript:ENSMMUT00000002085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDQELYRQTGNGFRCLNCNDNT
DGIHCERCKDGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDRGN
PEGCTQCFCYGHSASCRSSADYSVHKITSTFNQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSARRPDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTLRLNEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSAKLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPAEKCRACNCNPMGSEPVECRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGAVLDTELEGRMQQAEQAL
RDILRDAQISEGASRSLGLQLAKVRSQENSYRSRLDDLKMTVERVRALGSQYQNQVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTK
ETEDYSKQALSLVHKALREGGGSGSGSLDGAVVQGVVEKLEKTKSLAQQLTREATQAETE
ADRSYQHSLRLLDSVSQLQGVNDQTFQVEEAKRIKQKADSLSSLVTRHMDEFKRAQKNLG
DWKEETQQLLQNGKNGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAREALKISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQRVDTRAKNTGVTIQDTLNTLDGLLYLMDQPVSIDEEGLILLEQKLSRAKNQINSQLRP
MMSELEERARRQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTPVLEQQ
Download sequence
Identical sequences F7BDD8
XP_001114169.1.72884 XP_014977667.1.72884 XP_014977668.1.72884 9544.ENSMMUP00000001968 ENSMMUP00000001968 ENSMMUP00000001968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]