SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002103 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002103
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.52e-29
Family Ribosomal protein S14 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002103   Gene: ENSMMUG00000001573   Transcript: ENSMMUT00000002226
Sequence length 128
Comment pep:known chromosome:MMUL_1:1:204627131:204636078:-1 gene:ENSMMUG00000001573 transcript:ENSMMUT00000002226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMAYEYADERLRINSLRKN
TILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQL
SGIQRAMW
Download sequence
Identical sequences A0A096MUM0 A0A2K5ZC20 F7GV86 G7NVI9
ENSMMUP00000002103 9544.ENSMMUP00000002103 ENSPANP00000003536 XP_001104412.1.72884 ENSMMUP00000002103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]