SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002145 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002145
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-47
Family Glutathione peroxidase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002145   Gene: ENSMMUG00000001604   Transcript: ENSMMUT00000002269
Sequence length 209
Comment pep:known_by_projection chromosome:MMUL_1:6:52805547:52812226:1 gene:ENSMMUG00000001604 transcript:ENSMMUT00000002269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLAAYPLKCSGPRAKVFAVLLSMVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLALKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPIDVIRPDIAALVRKLIIKKKEDL
Download sequence
Identical sequences F7GUZ8
ENSMMUP00000002145 ENSMMUP00000002145 XP_001098032.1.72884 9544.ENSMMUP00000002145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]