SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002205 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002205
Domain Number 1 Region: 79-205
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.89e-67
Family RUNT domain 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002205   Gene: ENSMMUG00000001649   Transcript: ENSMMUT00000002334
Sequence length 480
Comment pep:known chromosome:MMUL_1:3:11522302:11781291:1 gene:ENSMMUG00000001649 transcript:ENSMMUT00000002334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDSIFESFPSYPQCFMRECILGMNPPRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
Download sequence
Identical sequences A0A2I3LQ88 A0A2K5NDS2 A0A2K5V4G1 A0A2K5XYL6 A0A2K6E9Y9 A0A2K6R9F3 H9YWG8
ENSMMUP00000002205 NP_001252891.1.72884 XP_005548791.1.63531 XP_007965627.1.81039 XP_010357174.1.97406 XP_011724438.1.29376 XP_011854531.1.47321 XP_011854532.1.47321 XP_011854533.1.47321 XP_011892564.1.92194 XP_014988376.1.72884 ENSMMUP00000002205 9544.ENSMMUP00000002205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]