SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002210 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002210
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.45e-35
Family RUNT domain 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002210   Gene: ENSMMUG00000001649   Transcript: ENSMMUT00000002339
Sequence length 348
Comment pep:known chromosome:MMUL_1:3:11521908:11781675:1 gene:ENSMMUG00000001649 transcript:ENSMMUT00000002339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
IKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRAS
LNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTT
LSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMG
SATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPC
TNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
Download sequence
Identical sequences ENSMMUP00000002210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]