SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002211 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002211
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.47e-68
Family RUNT domain 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002211   Gene: ENSMMUG00000001649   Transcript: ENSMMUT00000002340
Sequence length 250
Comment pep:known chromosome:MMUL_1:3:11685191:11752078:1 gene:ENSMMUG00000001649 transcript:ENSMMUT00000002340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QEEDTAAWRC
Download sequence
Identical sequences A0A2I3MWR4 A0A2K5IHN8 A0A2K5NDL1 A0A2K5V4N1 A0A2K6EA14 A0A2K6JQ67 A0A2K6R9D4 F7G6R8
ENSMMUP00000002211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]