SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002249 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002249
Domain Number 1 Region: 705-996
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-80
Family Protein kinases, catalytic subunit 0.00000000103
Further Details:      
 
Domain Number 2 Region: 325-517
Classification Level Classification E-value
Superfamily L domain-like 7.94e-45
Family L domain 0.00000197
Further Details:      
 
Domain Number 3 Region: 47-203
Classification Level Classification E-value
Superfamily L domain-like 4.54e-40
Family L domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 502-633
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.14e-22
Family Growth factor receptor domain 0.00000275
Further Details:      
 
Domain Number 5 Region: 193-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.82e-17
Family Growth factor receptor domain 0.00000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002249   Gene: ENSMMUG00000001674   Transcript: ENSMMUT00000002378
Sequence length 1298
Comment pep:known_by_projection chromosome:MMUL_1:12:75138625:76319657:-1 gene:ENSMMUG00000001674 transcript:ENSMMUT00000002378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCKKREKTGVGSCWAETPTSVTSMTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCIGSSIEDCIGLMDRTPLIAAGVIGGLFILVIVGLT
FAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFG
TVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSP
TIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVL
VKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKEL
AADFSILIFNIPKNILKDGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNI
PPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPE
APVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGY
MTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASNGPPKAEDEYVNEPLYLN
TFANALGKADYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQ
NGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
Download sequence
Identical sequences ENSMMUP00000002249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]