SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002285 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002285
Domain Number 1 Region: 158-266
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.00022
Further Details:      
 
Domain Number 2 Region: 482-590
Classification Level Classification E-value
Superfamily Cadherin-like 5e-19
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 267-341
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 418-489
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000228
Family Cadherin 0.0034
Further Details:      
 
Domain Number 5 Region: 79-165
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000757
Family Cadherin 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002285
Domain Number - Region: 565-643
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00897
Family Rhodopsin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002285   Gene: ENSMMUG00000001713   Transcript: ENSMMUT00000002417
Sequence length 796
Comment pep:known_by_projection chromosome:MMUL_1:18:54843921:54910225:1 gene:ENSMMUG00000001713 transcript:ENSMMUT00000002417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTSGRMSNAKNWLGLGMSLYFWGLMDLTTTVLSGTPTPQGELEALLSDKPQSHQRSKRS
WVWNQFFVLEEYTGTDPLYVGKLHSDMDRGDGSIKYILSGEGAGIVFTIDDTTGDIHAIQ
RLDREERAQYTLRAQALDRRTGRPMEPESEFIIKIQDINDNEPKFLDGPYVATVPEMSPV
GTSVIQVTATDADDPTYGNSARVVYSILQGQPYFSVDSKTGVIRTALMNMDREAKEYYEV
IIQAKDMGGQLGGLAGTTTVNITLSDVNDNPPRFPQKHYQMSVLESAPISSTVGRVFAKD
LDEGINAEMKYTIVDGDGADAFDISTDPNFQVGIITVKKVIQLLFLNHFHGKPLNPYVYM
QTLAQYLFCSLEEEMTFVFEQIKPRMHHASYGRHSVVSCGMLSYAYPNANDVYNPCFCRY
SIDRSSDSGRFFYVDITTGALMTARPLDREEFSWHNITVLAMEMNNPSQVGSVPVTIKVL
DVNDNAPEFPRFYEAFVCENAKAGQLIQTVSAVDQDDPRNGQHFYYSLAPEAANNPNFTI
RDNQDNTARILTRRSGFRQQEQSVFYLPILIADSGQPVLSSTGTLTIQVCSCDDNGHVMS
CSPEAYMLPVSLSRGALIAILACIFVLLVLVLLILSMRRHRKQPYIIDDEENIHENIVRY
DDEGGGEEDTEAFDIAAMWNPREAQAGTAPKTRQDMLPEIESLSRYVPQTCAVNSTVHSY
VLAKLYEADMDLWAPPFDSLQTYMFEGEGSVAGSLSSLQSATSDSEQNFDFLTDWGPRFR
KLAELYGASEGPAPLW
Download sequence
Identical sequences ENSMMUP00000002285 9544.ENSMMUP00000002285 ENSMMUP00000002285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]