SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002309 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002309
Domain Number 1 Region: 97-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.77e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-19
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 55-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000037
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002309   Gene: ENSMMUG00000030500   Transcript: ENSMMUT00000002441
Sequence length 201
Comment pep:novel scaffold:MMUL_1:1099214272851:48:1011:1 gene:ENSMMUG00000030500 transcript:ENSMMUT00000002441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WKSSYTCTICGKAFYLLNLFEKHQRTHTGEKPYKCKQCGKAFTVSGSCLIHERTHTREKP
YECKECRKTFRFSCSFKTCERTHTGERPYTCTKCDKAFSCSTSLRDHGSIHTGERPYECK
QCGKAFSGLSSLCNHRSTHTGEKAYECKQCDQAFSRLSSLHLHERIHTGEKPYECKRCGE
AYIRSSHLTCHERSHDICLNS
Download sequence
Identical sequences ENSMMUP00000002309 ENSMMUP00000002309 9544.ENSMMUP00000002309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]