SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002337 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002337
Domain Number 1 Region: 352-604
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-71
Family Protein kinases, catalytic subunit 0.000000000222
Further Details:      
 
Domain Number 2 Region: 11-137
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-32
Family SH2 domain 0.000000138
Further Details:      
 
Domain Number 3 Region: 147-260
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.000000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002337   Gene: ENSMMUG00000001748   Transcript: ENSMMUT00000002472
Sequence length 612
Comment pep:known chromosome:MMUL_1:15:102617129:102712170:1 gene:ENSMMUG00000001748 transcript:ENSMMUT00000002472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSGMADNANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRK
AHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFNRPQGVQPKTGPF
EDLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISREESEQ
IVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQL
VEHYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPAPSPAQGNRPESTVSFNPY
EPEVAPWAAEKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFG
TVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES
WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEECNFVHRDLAARNVLLV
TQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMW
EAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVE
LRLRNYYYDVVN
Download sequence
Identical sequences A0A1D5QW34 A0A2I3N2Y6 A0A2K5V790
XP_005582284.1.63531 XP_014973558.1.72884 XP_015292059.1.63531 ENSMMUP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]