SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002417 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002417
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-51
Family Calponin-homology domain, CH-domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 194-250
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.44e-19
Family EB1 dimerisation domain-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002417   Gene: ENSMMUG00000001816   Transcript: ENSMMUT00000002556
Sequence length 268
Comment pep:known_by_projection chromosome:MMUL_1:10:31703659:31735570:-1 gene:ENSMMUG00000001816 transcript:ENSMMUT00000002556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLSSSSAAPQRPMSTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDVCFVIPDEGGPQEEQEEY
Download sequence
Identical sequences G7PGM4
ENSMMUP00000002417 9544.ENSMMUP00000002417 ENSMMUP00000002417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]