SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002441
Domain Number 1 Region: 81-270
Classification Level Classification E-value
Superfamily L domain-like 7.65e-41
Family Ngr ectodomain-like 0.0091
Further Details:      
 
Domain Number 2 Region: 290-331,360-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000101
Family I set domains 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002441
Domain Number - Region: 570-609
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00729
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002441   Gene: ENSMMUG00000001835   Transcript: ENSMMUT00000002584
Sequence length 785
Comment pep:known_by_projection chromosome:MMUL_1:7:52919391:52926838:1 gene:ENSMMUG00000001835 transcript:ENSMMUT00000002584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNTCEYLPWAMFPALPHRVWRRGFSPRTFTESRRILGAVMFPLRALWLVWALLGGAGACP
EPCACVDKYAHQFADCAYKELREVPEGLPANVTTLSLSANKITVLRRGAFADVTQVTSLW
LAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPWSDLRNLSALQLLKMNHNRLGSLPRD
ALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHCGCGLVWLQAWAASTRV
SLPEPDSIACASPPALQGVPVYRLPTLPCAPPSVHLSAEPPLEAPSTPLRAGLAFMLHCI
ADGHPTPRLQWQLQIPGGTVVLEPPVLSGEDDGVGTEEGEGEEGDGDLLTQTQAPTPIPA
PAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNELGTNSTSVRVAVAATGPPKH
APGAGGEPDGQAPTSERKSTGKGRGNSVLPSKPEGKIKGQGLAKVSILGETETEPEEDIG
EGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFELGVIALDVAEREARV
QLTPLAARWGPGPGGAGGDRRRGRRPLRLLYLCPAGGGAAVQWSRVEEGVNAYWFRGLRP
GTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFLLVLATVPLLGAACCHLLAKH
PGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPAGGEAGGEEPEDAQGEGLDED
AEPGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNY
RQTAG
Download sequence
Identical sequences ENSMMUP00000002441 9544.ENSMMUP00000002441 ENSMMUP00000002441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]