SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002540 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002540
Domain Number 1 Region: 26-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-27
Family PDI-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002540   Gene: ENSMMUG00000001901   Transcript: ENSMMUT00000002688
Sequence length 280
Comment pep:known_by_projection chromosome:MMUL_1:7:114288133:114304661:1 gene:ENSMMUG00000001901 transcript:ENSMMUT00000002688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSGSPAVTLAVLVLLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQ
NLQPEWESFAEWGEDLEVNVAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTK
KDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRACHNYFIEDLGLPVWGS
YTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQE
ADEEDVSEEETERKEGTNKDFPQNAIRQRSLGPSLATDKS
Download sequence
Identical sequences F7FWZ6
9544.ENSMMUP00000002540 ENSMMUP00000002540 XP_001102891.1.72884 ENSMMUP00000002540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]