SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002544 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002544
Domain Number 1 Region: 89-211
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002544
Domain Number - Region: 59-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000629
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 293-330
Classification Level Classification E-value
Superfamily Kelch motif 0.00144
Family Kelch motif 0.032
Further Details:      
 
Domain Number - Region: 212-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.083
Further Details:      
 
Domain Number - Region: 250-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0364
Family Integrin beta EGF-like domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002544   Gene: ENSMMUG00000001905   Transcript: ENSMMUT00000002692
Sequence length 397
Comment pep:known_by_projection chromosome:MMUL_1:9:114739474:114807309:1 gene:ENSMMUG00000001905 transcript:ENSMMUT00000002692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGAPQPATPGLWRARPAGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQSK
PCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTW
LIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVV
TTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVPSQVYCDCDKYWKG
EACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSP
SVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLKKTSLCMEAELKQMMAMSQMNYGFLTY
IVSHGVQKLLLFLDMVSSMLWRDIQHILWSWIVEMLS
Download sequence
Identical sequences A0A2K5WBA3 A0A2K6DA98 F7FWY3
ENSMMUP00000002544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]