SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002741 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002741
Domain Number 1 Region: 340-753
Classification Level Classification E-value
Superfamily Phosphofructokinase 9.55e-110
Family Phosphofructokinase 0.00000789
Further Details:      
 
Domain Number 2 Region: 16-339
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.88e-105
Family Phosphofructokinase 0.000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002741   Gene: ENSMMUG00000002045   Transcript: ENSMMUT00000002899
Sequence length 780
Comment pep:known chromosome:MMUL_1:11:45199492:45225692:1 gene:ENSMMUG00000002045 transcript:ENSMMUT00000002899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLGDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALLF
QPVTELQGQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEGAV
Download sequence
Identical sequences A0A2K5L8W6 H9ERR6
ENSMMUP00000002741 XP_002798593.1.72884 XP_002798594.1.72884 XP_005570754.2.63531 XP_005570755.1.63531 XP_005570756.1.63531 XP_008001223.1.81039 XP_011758618.1.29376 XP_011758619.1.29376 XP_011758620.1.29376 XP_011758621.1.29376 XP_011758622.1.29376 XP_011758623.1.29376 XP_011843046.1.47321 XP_011843047.1.47321 XP_011903899.1.92194 XP_011903900.1.92194 XP_011903901.1.92194 XP_011903902.1.92194 XP_015007037.1.72884 XP_015007039.1.72884 XP_015007040.1.72884 XP_015007041.1.72884 XP_015286334.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]