SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002742 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002742
Domain Number 1 Region: 309-722
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.5e-110
Family Phosphofructokinase 0.00000789
Further Details:      
 
Domain Number 2 Region: 16-308
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.28e-86
Family Phosphofructokinase 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002742   Gene: ENSMMUG00000002045   Transcript: ENSMMUT00000002900
Sequence length 749
Comment pep:known chromosome:MMUL_1:11:45202872:45225692:1 gene:ENSMMUG00000002045 transcript:ENSMMUT00000002900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLGDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSEDIKNGSRMGVEAVMALLEGTPDT
PACVVSLSGNQAVRLPLMECVQVTKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHV
RPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEA
GWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEG
RKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIE
TMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKC
NENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKI
KESYRNGRIFANTPDSGCVLGMRKRALLFQPVTELQGQTDFEHRIPKEQWWLKLRPILKI
LAKYEIDLDTSDHAHLEHITRKRSGEGAV
Download sequence
Identical sequences A0A2I3MXT9 A0A2K5L972 A0A2K5WK70 A0A2K5XIS3 A0A2K6CRZ7 F6WXR9
ENSMMUP00000002742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]