SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002744 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002744
Domain Number 1 Region: 94-241
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.4e-22
Family Glutathione peroxidase-like 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002744   Gene: ENSMMUG00000002049   Transcript: ENSMMUT00000002902
Sequence length 248
Comment pep:novel chromosome:MMUL_1:11:45238368:45239166:-1 gene:ENSMMUG00000002049 transcript:ENSMMUT00000002902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVRVLPRQFCMQEEVWHDWRLAGSCLGSRPLRWSGPEQKDCRDCTCPLKPRPISWKSLAF
TFAMGGGLLAGVKYSKEKTEAREEKAVKHQQAFIGGPFSLTTHGEPKTDKDCLGQWLLIY
SCFSHYWYLCEELEKMIQVVDEIVFQLCQIIDPERDTKKAIANYVKEFSLKLVGLTGTKE
EINHVARAYRVYYSSSPKDEDEDYVNHTIIMSLIGLDGEFPDYFGPGRMQKLLASSIAAH
MRAHKKKE
Download sequence
Identical sequences ENSMMUP00000002744 9544.ENSMMUP00000002744 ENSMMUP00000002744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]