SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002752 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002752
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-43
Family Calponin-homology domain, CH-domain 0.000000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002752   Gene: ENSMMUG00000002058   Transcript: ENSMMUT00000002912
Sequence length 201
Comment pep:known chromosome:MMUL_1:14:115597814:115603215:1 gene:ENSMMUG00000002058 transcript:ENSMMUT00000002912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEG
KDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
TNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences A0A0D9S3B7 A0A2K5HQ68 A0A2K5P5S4 A0A2K5XNS6 A0A2K6BLI9 A0A2K6KU50 A0A2K6N7N3 F6WXC6 Q2PG59
ENSMMUP00000002752 ENSMMUP00000036681 9544.ENSMMUP00000002752 ENSPANP00000005335 NP_001270641.1.63531 XP_008019196.1.81039 XP_010365710.1.97406 XP_011730705.1.29376 XP_011782224.1.43180 XP_011782225.1.43180 XP_011782226.1.43180 XP_011782227.1.43180 XP_011837328.1.47321 XP_011837332.1.47321 XP_011837341.1.47321 XP_011837346.1.47321 XP_011908291.1.92194 XP_011908292.1.92194 XP_014971262.1.72884 XP_017738592.1.44346 ENSMMUP00000002752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]