SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002879 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002879
Domain Number 1 Region: 33-89
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 2 Region: 128-184
Classification Level Classification E-value
Superfamily BPTI-like 2.13e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002879   Gene: ENSMMUG00000002158   Transcript: ENSMMUT00000003047
Sequence length 252
Comment pep:known chromosome:MMUL_1:19:44586282:44619498:1 gene:ENSMMUG00000002158 transcript:ENSMMUT00000003047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLCGLRRGRALLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTD
GSCQLFVYGGCDGNSNNYMSKEECLKKCAAVTENATGDLATSRNAADSSVPSVPRRQDSD
DHSSDMFNYEEYCAAKAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACM
LRCFRQQENPSLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGD
DKEQLVKNTYVL
Download sequence
Identical sequences A0A0D9QVT2 A0A2K5YWS0 A0A2K6B6R5 H9EX54
ENSMMUP00000002879 NP_001181272.1.72884 XP_007994851.1.81039 XP_011763208.1.29376 XP_011828708.1.47321 ENSMMUP00000002879 9544.ENSMMUP00000002879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]