SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002972 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002972
Domain Number 1 Region: 182-311
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-32
Family Pleckstrin-homology domain (PH domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 346-454
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 7.06e-22
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002972   Gene: ENSMMUG00000002223   Transcript: ENSMMUT00000003148
Sequence length 570
Comment pep:known chromosome:MMUL_1:11:112358207:112389201:1 gene:ENSMMUG00000002223 transcript:ENSMMUT00000003148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSSASSPPSASPAPAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGLAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGEVPAAHTAAAVGTPGEAAETPARPGLAK
KLLPWSLAREPPPEALKEAALRYSLADEASMDSGARWQRGRLALRRAPGSDGPDGPDRVL
ELFDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNS
WMAELRECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDH
FLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLS
LTERGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLF
PFSLPHWDSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLRHLEPE
PVNRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences F6W719
ENSMMUP00000002972 9544.ENSMMUP00000002972 ENSMMUP00000002972 XP_001108790.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]