SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002980 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002980
Domain Number 1 Region: 420-458
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000222
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002980
Domain Number - Region: 230-240
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 175-242
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0256
Family beta-sandwich domain of Sec23/24 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002980   Gene: ENSMMUG00000002227   Transcript: ENSMMUT00000003157
Sequence length 460
Comment pep:known_by_projection chromosome:MMUL_1:1:144864382:144899214:1 gene:ENSMMUG00000002227 transcript:ENSMMUT00000003157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERL
ERERLERERLEQEQLERERQERERQERLERQERLDRERQERQERERLERLERERQERERQ
EQLEREQLEWERERRISSAGKKFSLPPCSSPLRYSSSSSEQKLSTSSPVNTPSSQPPATK
PSAPPPPPPLPSLASLSHCGSQASPPPSTPIASTPSSKPSPAETPAQQVPPPPPPPPAPP
LPASGFFLASVSEDNRPLTGLAAAIAGAKLRKVSRMEDASFPSGGNAIGVNSASSKADTG
RGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTVETEQKEDKGEDSEPVTSKASSTSTPE
PTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTE
GLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Download sequence
Identical sequences ENSMMUP00000002980 ENSMMUP00000002979 9544.ENSMMUP00000002980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]