SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002985 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002985
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000438
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 221-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000182
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002985
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 273-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002985   Gene: ENSMMUG00000002234   Transcript: ENSMMUT00000003163
Sequence length 439
Comment pep:known_by_projection chromosome:MMUL_1:13:111553962:111602105:1 gene:ENSMMUG00000002234 transcript:ENSMMUT00000003163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVSRVAPDAPPVSCPALNAPADGRKFGSKYLVDHEVHFACNPGFRLVGPSSVV
CLPNGTWTGEQPRCRDISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCEDVNECELYGQEGRPRLC
MHTCVNTPGSYRCTCPSGYLTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGSSRGHFVMQRSDRQTGELILVQTLAGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences A0A1D5R1V2
ENSMMUP00000002985 XP_001087308.1.72884 ENSMMUP00000002985 9544.ENSMMUP00000002985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]