SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002989
Domain Number 1 Region: 208-277
Classification Level Classification E-value
Superfamily Homeodomain-like 7.27e-20
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 82-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000286
Family LIM domain 0.012
Further Details:      
 
Domain Number 3 Region: 52-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000127
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000002989
Domain Number - Region: 143-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0357
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002989   Gene: ENSMMUG00000002236   Transcript: ENSMMUT00000003167
Sequence length 402
Comment pep:known chromosome:MMUL_1:15:99901417:99984900:-1 gene:ENSMMUG00000002236 transcript:ENSMMUT00000003167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQ
RPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCME
KIAPTEFVMRALECVYHLGCFCCCVCERQLRKGDEFVLKEGQLLCKGDYEKEKDLLSSVS
PDESDSVKSEDEDGDMKPAKGQGSQSKGSGDDGKDPRRPKRPRTILTTQQRRAFKASFEV
SSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRHQQQQEQQNSQRLGQEVLSS
RMEGMMASYTPLAPPQQQIVAMEQSPYGSSDPFQQGLTPPQMPGDHMNPYGNDSIFHDID
SDTSLTSLSDCFLGSSDVGSLQARVGNPIDRLYSMQSSYFAS
Download sequence
Identical sequences A0A0D9RMI6 A0A2J8UKH7 A0A2K6C4K9 A0A2K6F7D5 A0A2K6U446 D2H3X4 H0WI04 H2QXW6 M3VWN9 O60663
ENSOGAP00000001035 gi|292494915|ref|NP_001167618.1| ENSP00000362573 ENSMMUP00000002989 9544.ENSMMUP00000002989 ENSAMEP00000017585 ENSMMUP00000002989 ENSOGAP00000001035 ENSFCAP00000001349 ENSP00000362573 ENSAMEP00000017585 NP_001167618.1.87134 NP_001167618.1.92137 XP_002916366.1.58354 XP_003407776.1.64505 XP_003995930.1.62641 XP_004269260.1.21590 XP_004671711.1.11716 XP_004757358.1.14098 XP_005346073.1.66349 XP_006834839.1.41390 XP_006988780.1.50099 XP_007471768.1.90284 XP_008004408.1.81039 XP_008153533.1.99482 XP_008823110.1.79516 XP_009243138.1.23681 XP_010349655.1.74449 XP_011709676.1.29376 XP_012313307.1.9421 XP_012495143.1.63892 XP_012495144.1.63892 XP_012657833.1.62490 XP_016817162.1.37143 XP_017911274.1.57651 XP_019276670.1.44245 XP_021049166.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]