SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003029 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003029
Domain Number 1 Region: 430-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000246
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 2 Region: 271-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000272
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 3 Region: 383-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 327-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003029
Domain Number - Region: 85-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000238
Family CBM4/9 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003029   Gene: ENSMMUG00000002267   Transcript: ENSMMUT00000003209
Sequence length 530
Comment pep:known_by_projection chromosome:MMUL_1:15:7708544:7783508:-1 gene:ENSMMUG00000002267 transcript:ENSMMUT00000003209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALLLGLALLAPRAAGSGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLL
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGTD
CECCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCTCKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPHSGRCPCKENVEGNLCDRCRPGTFNLQPHNPPGSRSC
RSKASRVTSPRSALTNGTWRPFCTACLRTVPAGSEGCPDPRHTLPHLLFT
Download sequence
Identical sequences ENSMMUP00000003029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]