SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003032 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003032
Domain Number 1 Region: 271-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000481
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 2 Region: 707-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 3 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000257
Family Laminin-type module 0.006
Further Details:      
 
Domain Number 4 Region: 383-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 327-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003032
Domain Number - Region: 85-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000425
Family CBM4/9 0.085
Further Details:      
 
Domain Number - Region: 669-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family Laminin-type module 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003032   Gene: ENSMMUG00000002267   Transcript: ENSMMUT00000003212
Sequence length 783
Comment pep:known_by_projection chromosome:MMUL_1:15:7694998:7783508:-1 gene:ENSMMUG00000002267 transcript:ENSMMUT00000003212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALLLGLALLAPRAAGSGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAQCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLL
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDAAGQLACRCQHNTTGTD
CECCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCHSAGSLHLQCDDTGTCTCKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPHSGRCPCKENVEGNLCDRCRPGTFNLQPHNPVGCSSC
FCYGHSKVCAATAQFQVHHIFTDFHQGKSRAWWRRLCGGVLHAPQTSTRSTALQPGRQSE
TPCPGKFLGDQRFSYGQPLILTFQVPPRSSPLPVQLRLEGAGLALSLRHSSLSGPQDRAS
QGGRAQVPVTETSEDVAPPLPPFHFQRLLTNLTSLRLRVSPGPSPAGQVFLTEVRLTSAR
PGLSPPASWVETCSCPSGYMGQFCESCAPGYKRETPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESGEVACTHCPPG
QRG
Download sequence
Identical sequences ENSMMUP00000003032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]