SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003089 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003089
Domain Number 1 Region: 47-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000115
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003089   Gene: ENSMMUG00000002312   Transcript: ENSMMUT00000003272
Sequence length 133
Comment pep:known_by_projection chromosome:MMUL_1:5:55259364:55264420:-1 gene:ENSMMUG00000002312 transcript:ENSMMUT00000003272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEVPISVYLLFNAMTALTEEAAVTVTPPITAQQTDNVEGPIALKFSHLCLEDHNSYCI
NGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIF
YCYIRKRYEKDKI
Download sequence
Identical sequences A0A1D5Q982
ENSMMUP00000003089 9544.ENSMMUP00000003089 ENSMMUP00000003089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]