SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003249 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003249
Domain Number 1 Region: 56-181
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.48e-66
Family RUNT domain 0.000000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003249   Gene: ENSMMUG00000002420   Transcript: ENSMMUT00000003439
Sequence length 419
Comment pep:known_by_projection chromosome:MMUL_1:1:27525734:27554414:-1 gene:ENSMMUG00000002420 transcript:ENSMMUT00000003439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIPVDPSTSRRFTPPSTAFPCGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLAD
HAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAEL
RNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPR
RHPEPWHPDPTSREFWSIKATRAWLRPSIPAPRGRLGSALHNSPAPPIPLAPSPRASEFA
GPRKASGSVPSCPTVVDSLFPLFESPGITCPGPRKHTEPWSAQSSKGAVLSSGLSSGLPA
LVQLRHQVLPPPPRRRSGAPQLQDGQLPLXPSPYHLYYGTSSGSYQFSMVAGSSSGGDRS
PTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
Download sequence
Identical sequences ENSMMUP00000003249 9544.ENSMMUP00000003249 ENSMMUP00000003249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]