SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003298 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003298
Domain Number 1 Region: 326-424
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000011
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003298   Gene: ENSMMUG00000002447   Transcript: ENSMMUT00000003489
Sequence length 508
Comment pep:known_by_projection chromosome:MMUL_1:X:34093856:34171772:1 gene:ENSMMUG00000002447 transcript:ENSMMUT00000003489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIHLDKQNIILKNDKDEYLSKTGDGVLPPCRDAKSPRPASIKKTHTTSKFNDAEPAKGK
LFIGVEVLPEHLHLDESETSKEDNGSMEKENYEQFLSLEEGTKAHCFFEKVVNAAHTWFS
LFGWPEGPHSFSIPETIRRDVYKMRLYSSTSPPQKFSKQNDFSKFNKTIYDVLLHLSGKM
PPGINSSQSLPVDNHEKRVIQLHLQHSSLLDFLSAQGGCISHVLPEFLLEPEDYKRWIEI
KSSTNTMPESSCTPKKKCSIVIEMSKFETWSKRAWTDVFLQIYKVFVLSRVVPYCSNNMP
PKYVQNTAKVNPCFASSNIYSDSERILLSWMNVNYENTRHVIWKNCHKETDVIPSERWIV
NFDKDLSDGLVFATQLGAYCPFLIESHFINMYTRPKSPEEYLHNCLIIVNTLYEIDFDME
IQMKEEINVMQSDTSKTVWKRQNLIGIWKERLMILVPKMISYTTGEKSFIITHFFLCIKF
IFIFCLKISFISCWGNVMSFWRILPVGI
Download sequence
Identical sequences ENSMMUP00000003298 ENSMMUP00000003298 9544.ENSMMUP00000003298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]