SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003371 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003371
Domain Number 1 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000133
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000154
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003371
Domain Number - Region: 476-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000993
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 3-77
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0285
Family LIM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003371   Gene: ENSMMUG00000002506   Transcript: ENSMMUT00000003567
Sequence length 539
Comment pep:known chromosome:MMUL_1:20:87845180:87861625:1 gene:ENSMMUG00000002506 transcript:ENSMMUT00000003567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCRLCHGKFSSRSLRGISERAPGASVERPSAEERVLVRDFQRLLGVAVRQDPALSQFV
CKSCHAQFYQCHSLLRSFLQRVNVSPTGRRKPCAKVGAQLPAGAEEGACLVDLITSSPQC
LHGLVGWVHGHAASCRALPHLQRTLSSEYCGVIQAVWGCDQGHDYTMDTSSSCKAFLLDS
ALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGKGTGTPVGAETKILPSTDEAQPPSDSD
AVGPRSGFPPQPSLPLCGAPGQLGEKQVPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQN
AQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYK
CPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVRN
YICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAETELDFA
CDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPPPGPPSPSVTTEDQAVKPEPT
Download sequence
Identical sequences A0A2K5U5C1 F7HEI8
ENSMMUP00000003371 9544.ENSMMUP00000003371 ENSMMUP00000003371 XP_005592885.1.63531 XP_014982312.1.72884 XP_015298445.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]