SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003490 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003490
Domain Number 1 Region: 1009-1211
Classification Level Classification E-value
Superfamily vWA-like 2.86e-58
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 2 Region: 142-337
Classification Level Classification E-value
Superfamily vWA-like 2.97e-57
Family Integrin A (or I) domain 0.0000943
Further Details:      
 
Domain Number 3 Region: 1230-1433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.1e-35
Family Laminin G-like module 0.036
Further Details:      
 
Domain Number 4 Region: 447-615
Classification Level Classification E-value
Superfamily Fibronectin type III 2.75e-22
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 5 Region: 32-123,344-429
Classification Level Classification E-value
Superfamily Fibronectin type III 6.11e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 6 Region: 739-909
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 630-712
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000111
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 8 Region: 922-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000487
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003490   Gene: ENSMMUG00000002595   Transcript: ENSMMUT00000003696
Sequence length 1782
Comment pep:known chromosome:MMUL_1:8:122667600:122891057:1 gene:ENSMMUG00000002595 transcript:ENSMMUT00000003696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILQCKMRYWLLPPFLAIVYFCTIVQGQVAPPTRLRYNVISHDSIQISWKAPRGKFGGY
KLLVTPASGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPVQGQFRIKDL
EKRKDPKPRVKVVDRGNGSRPSSPEEVKFVCQTPAIADIVILVDGSWSIGRFNFRLVRLF
LENLVTAFDVGSEKTRIGLAQYSGDPRIEWHLNAFSTKDEVIEAVRNLPYKGGNTLTGLA
LNYIFENSFKPEAGSRTGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADVN
ELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDREIKASAHAITGPPTELI
TSEVTARSFMVNWTHAPGNVEKYRVVYYPTRGGKPDEVVVDGSVSSTVLKNLMSLTEYQI
AVFAIYAHTASEGLRGTETTLALPMASDLLLYDVTENSMRVKWDAVPGASGYLILYAPLT
EDLAGDEKEMKIGETHTDIELSGLLPNTEYTVTVYAMFGEEASDPVTGQETTLALSPPRN
LRISNIGSNSARLTWDPTSRQINGYRIVYNNADGTEINEVEVDPITTFPLKGLTPLTEYT
VAIFSIYDEGQSEPLTGVFTTEEVPAQQYLEIDEVTTDSFRVTWHPLSADEGLHKLMWIP
VYGGKTEEVVLREEQDSHVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTLDSFWTEP
ATTMVPTTPVTSVFQTGIRNLVVGDETTSSLRVKWDISDSDVQQFRVTYLTVQGDPEEEV
VGTIMVPGSQNNLLLKPLLPDTEYKVTVTPIYTDGEGVSVSAPGKTLPSSAPQNLRVSEE
WYNRLRITWDPPSSPVKGYRIVYKPVSVPGPTLETFVGADINTILITNLLSGMDYNVKIF
ASQASGFSDALTGMVKTLFLGVTNLQAIHVEMTSLCAHWQVHRHATAYRVVIESLQDTKK
QESTVGGGTTRHCFYGLQPDSEYKISVYTKLQEIEGPSVSIMEKTQSLPTQPPTFPPTIP
PAKEVCKAAKADLVFMVDGSWSIGDDNFNKIISFLYSTVGALNKIGTDGTQVAMVQFTDD
PRTEFKLNAYKTKETLLDAIKHISYKGGNTKTGKAIKYVRDSLFTAESGTRRGIPKVIVV
ITDGRSQDDVNKISREMQLDGYSIFAIGVADADYSELVSIGSKPSARHVFFVDDFDAFKK
IEDELITFVCETASATCPMVHKDGIDLAGFKMMEMFGLVEKDFSSVKGVSMEPGTFNVFP
CYQLHKDALVSQPTRYMHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVI
LDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSDTLVKLVIDCKQVGE
KAINASANITSDGVEVLGKMVRSRGPDGNSAPFQLQMFDIVCSTSWANTDKCCELPGLRD
DESCPDLPHSCSCTETNEVALGPAGPPGGPGLRGPKGQQGEPGPKGPDGPRGEVGLPGPQ
GPPGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGPQGIPGGVGSPGRDGSPGQRGLPGKDG
SSGPPGPPGPIGIPGAPGVPGITGSMGPQGALGPPGVPGAKGERGERVSQASLELLTSTA
PTPCPALASQSAGITGVIQRWSAVARSQLTASSASRVPAILLPQPPEQLGPQAPPPRPAN
FLLQAGVRPVPGHVSLTGVKGEKGNPGVGTQGPRGPPGPAGPSGESRPGSPGPPGSPGPR
GPPGHLGVPGPQGPSGQPGYCDPSSCSAYGVRDLIPYNDYQH
Download sequence
Identical sequences ENSMMUP00000003490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]