SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003511 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003511
Domain Number 1 Region: 28-211,292-447
Classification Level Classification E-value
Superfamily L domain-like 2.93e-51
Family Ngr ectodomain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 507-673,754-868
Classification Level Classification E-value
Superfamily L domain-like 4.38e-50
Family Ngr ectodomain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1142-1330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.52e-27
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 4 Region: 983-1111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 913-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000366
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 1326-1367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000242
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003511
Domain Number - Region: 1417-1445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 1369-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000552
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003511   Gene: ENSMMUG00000002614   Transcript: ENSMMUT00000003717
Sequence length 1526
Comment pep:known chromosome:MMUL_1:5:15037163:15403015:1 gene:ENSMMUG00000002614 transcript:ENSMMUT00000003717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGVGWQMLSLSLGLVLAILNTVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPE
LLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPE
TITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKI
TELPKSLFEGLFSLQLLFSLLKGKNLKKFSPSPWRKIFFLSLYNNMLQTIANGIVSPLRI
HTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRCSAKE
QYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPEHIPQYTAELRLNN
NEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMF
KGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLL
ANPFNCNCYLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCS
PLSRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLI
DLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISAVPE
GAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPS
KKFTCQGPVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKVKEIDFCIQKLQ
REHSHFAIARKTNILFSDSFLCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTC
LCPPEYTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQD
NKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIVRINE
PICQCLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQVRDLLETGFHRVSQD
DLALENYRKESREPLKGKNQPTFCFRCSVETINDGNFHIVELLALDQSLSLSVDGGSPKI
ITNLSKQSTLNFDSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKV
PMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHG
TCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYT
GDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRRKYS
FECTDGSSFVDEVEKVVKCGCTRCAS
Download sequence
Identical sequences ENSMMUP00000003511 9544.ENSMMUP00000003511 ENSMMUP00000003511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]