SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003525 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003525
Domain Number 1 Region: 955-1082,1114-1321
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-66
Family p120GAP domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 26-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-38
Family Calponin-homology domain, CH-domain 0.0000263
Further Details:      
 
Domain Number 3 Region: 1537-1634
Classification Level Classification E-value
Superfamily RGC domain-like 1.96e-30
Family RGC domain 0.0000107
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003525
Domain Number - Region: 670-699
Classification Level Classification E-value
Superfamily WW domain 0.000133
Family WW domain 0.0024
Further Details:      
 
Domain Number - Region: 732-818
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000159
Family Motor proteins 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003525   Gene: ENSMMUG00000002621   Transcript: ENSMMUT00000003731
Sequence length 1634
Comment pep:known_by_projection chromosome:MMUL_1:1:135134636:135179179:-1 gene:ENSMMUG00000002621 transcript:ENSMMUT00000003731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRAAGPGRAAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWMEACLKEELPSPVELEE
SLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTDNINFWLSAIAHIGLPS
TFFPETTDIYDKKNMPRVVYCIHALSLFLFRLGLAPQIHDLYGKVKFTAEELSNMASELA
KYGLQLPAFSKIGGILANELSVDEAAVHAAVLAINEAVERGVVEDTLAALQNPSALLENL
REPLAAIYQEILAQAKMEKAANARNHDERESQDIYDHYLTQAEIQGNINHVNVHGALEVV
DDALERQSPEVLLKALQDPALALRGVRRDFAVWYLEQLSSDREQKAQELGLVELLEKEEV
QAGVAAANTKGDQEQAMLHAVQRINKAIQRGVAADTVKELMCPEAQLPPVYPVASAMYQQ
ELAVLQRQQQGELGQEELFVAVEMLSAVVLINRALEAQDASGFWSSLVNPATGLAEVEGE
NAQRYFDALLKLRQERGMGEDFLSWNDLQATVSQVNAQDQEETDRVLAISLINEALDKGS
PEKTLSALLLPAAGLDDISLPVAPRYHLLLVAAKRQKAQVTGDPGAVLWLEEIRQGVVRA
NQDTNTAQRMALGVAAINQAIKEGKAAQTERVLRNPAVALRGVVPNCANGYQRALEGAMA
KKQRPADSAFWVQHDMNDGTAYYFHLQTFQGTWEQPSGCRLHTSHLTREEIQSAVTKVTA
AYDRQQLWKANTGFVVQLQARLRGFLVRQKFAEHSHFLRTWLPAVIQIQAHWRGYRQRKI
YLERLQYFKANLDAIIKIQAWARMWATRRQYLRRLHYFQKNVSSIVKIQAFFRARKAQDD
YRILVHAPHPPLSVVRRFAHLLNQSQQDFLAEAELLKLQEEVVRKIRSNQQLEQDLNIMD
IKIGLLVKNRITLQEVVSHCKKLTKRNKEQLSDMMVLDKQKGLKSLSKEQRQKLEAYQHL
FYLLQTQPIYLAKLIFQMPQNKTTKFMEAVIFSLYNYASSRREAYLLLQLFKTALQEEVK
SKVEQPQDVVTGNPTVVRLVVRFYRNGRGQSALQEILGKVIQDVLEDKVLSVHTDPVHLY
KNWINQTEAQTGQRSHLPYDVTPEQALSHPEVQRQLDIALRNLLAMTDKFLVAITSSVDQ
IPYGMRYVAKVLKATLAEKFPDATDSEVYKASVVGNLLYYRFLNPAVVAPDAFDIVAMAA
GGTLAAPQRHALGAVAQLLQHAAAGKAFSGQSQHLRVLNDYLEETHLKFRKFIHRACQVP
EPEERFAVDEYSDMVAVAKPVVYITVGELVNTHRLLLEHQDCIASDHQDPLHELLEDLGE
LPTIPDLIGESIAADGHTDLSKLEVSLTLTNKFEGLEADTDDSNTRSLLLSTKQLLADII
QFHPGDTLKEILSLSASREQEAAHKQLMSRRQACAAQTPEPLRRHRSLTAHSLLPLAEKQ
RRVLRNLRQLEALGLVSARNGYQGLVDELAKDIRNQHRHRHRRKAELVKLQATLQGLSTK
TTFYEEQGDYYSQYIRACLDHLAPDSMSSGKGKKQPSLHYTAAQLLEKGVLVEIEDLPAS
HFRNVIFDITPGDEAGKFEVNAKFLGVDMERFQLHYQDLLQLQYEGVAVMKLFNKAKVNV
NLLIFLLNKKFLRK
Download sequence
Identical sequences 9544.ENSMMUP00000003525 ENSMMUP00000003525 ENSMMUP00000003526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]