SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003679
Domain Number 1 Region: 205-437
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.71e-82
Family Fibrinogen C-terminal domain-like 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003679   Gene: ENSMMUG00000002737   Transcript: ENSMMUT00000003893
Sequence length 439
Comment pep:known chromosome:MMUL_1:3:140168582:140172272:1 gene:ENSMMUG00000002737 transcript:ENSMMUT00000003893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLANWYWLSSAVLATYSFLVVANNETEEIKDERAKDICPVRLESRGKCEEAGECPYQVS
LPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTG
APGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANL
TFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNRSFEV
YCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
RIDLEDFNGVKLYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPD
KDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGG
YKSSFKEAKMMIRPKHFKP
Download sequence
Identical sequences A0A2K5WID3 F7HKS2
NP_001247603.1.72884 XP_005550475.1.63531 9544.ENSMMUP00000003679 ENSMMUP00000003679 ENSMMUP00000003679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]