SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003722 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003722
Domain Number 1 Region: 8-135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-38
Family Dual specificity phosphatase-like 0.000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003722   Gene: ENSMMUG00000002777   Transcript: ENSMMUT00000003940
Sequence length 135
Comment pep:novel chromosome:MMUL_1:4:59992837:60000505:1 gene:ENSMMUG00000002777 transcript:ENSMMUT00000003940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEK
EGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALI
EGGMKYEDAVQFIRQ
Download sequence
Identical sequences A0A0D9RM15 A0A1U7QQS2
ENSMMUP00000003722 XP_005084075.1.91757 XP_005084076.1.91757 XP_015343376.1.40921 XP_016866761.1.92137 XP_021053995.1.100879 9544.ENSMMUP00000003722 ENSMMUP00000003722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]