SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003726
Domain Number 1 Region: 43-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000285
Family EGF-type module 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003726   Gene: ENSMMUG00000002778   Transcript: ENSMMUT00000003944
Sequence length 157
Comment pep:known_by_projection chromosome:MMUL_1:5:54792535:54815933:1 gene:ENSMMUG00000002778 transcript:ENSMMUT00000003944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLVILQCVVADGNSTRSPETNGLLCGDPDENCAATTTQSKRKGHFSRCPKQYKHYCIKGR
CRFVVTEQTPSCVCDEGYIGARCERVDLFYLKGDRGQILVICLIAVMVVFIILVIGVCTC
CHPLRKRRKRKKKEEEMQTLGKDITPINEDIEETNIS
Download sequence
Identical sequences ENSMMUP00000003726 9544.ENSMMUP00000003726 ENSMMUP00000003726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]