SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003795 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003795
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.07e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 217-317
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000487
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003795
Domain Number - Region: 177-211
Classification Level Classification E-value
Superfamily SARS Nsp1-like 0.0314
Family SARS Nsp1-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003795   Gene: ENSMMUG00000002839   Transcript: ENSMMUT00000004020
Sequence length 367
Comment pep:known chromosome:MMUL_1:10:20171071:20203972:-1 gene:ENSMMUG00000002839 transcript:ENSMMUT00000004020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGEHVVALMPEVGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
YLKKKYI
Download sequence
Identical sequences A0A0D9RNQ5 A0A2K5LZN7 A0A2K6CB84 F7GYB1 Q4R514 U3CTE0
9544.ENSMMUP00000003795 ENSMMUP00000003795 NP_001244460.1.72884 NP_001271059.1.63531 XP_008014928.1.81039 XP_008994216.1.60252 XP_011765081.1.29376 XP_011853042.1.47321 XP_011921110.1.92194 ENSMMUP00000003796 ENSPANP00000017698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]