SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003796 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003796
Domain Number 1 Region: 39-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.57e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0076
Further Details:      
 
Domain Number 2 Region: 217-315
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000356
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003796
Domain Number - Region: 175-209
Classification Level Classification E-value
Superfamily SARS Nsp1-like 0.0314
Family SARS Nsp1-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003796   Gene: ENSMMUG00000002839   Transcript: ENSMMUT00000004021
Sequence length 365
Comment pep:known chromosome:MMUL_1:10:20171071:20203972:-1 gene:ENSMMUG00000002839 transcript:ENSMMUT00000004021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPNNLTPTNCSWWPISALESCGQAGGGPRRSRGGQPHWPRESLVLYHWTQSFSSQKVR
LVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTF
TGEHVVALMPEVGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIR
RHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIE
AELEKRKLENEGGAEMRAVALWLCLHADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFF
ERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYWYL
KKKYI
Download sequence
Identical sequences ENSMMUP00000003796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]