SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003862 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003862
Domain Number 1 Region: 214-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-49
Family SPRY domain 0.0000516
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000013
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003862
Domain Number - Region: 39-155
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00418
Family Apolipoprotein A-I 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003862   Gene: ENSMMUG00000002890   Transcript: ENSMMUT00000004093
Sequence length 383
Comment pep:known chromosome:MMUL_1:4:29744489:29752894:1 gene:ENSMMUG00000002890 transcript:ENSMMUT00000004093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSMERD
EIEDVKCREDQKLQVLLTQIENKKHQVEAAFERLQQELEQQRCLLLARLKELEQQIWKER
DEYITKVSEEVTRLGAQVKELEEKCQQPASELLQNCPSHTLWCEMKTFVSPEAISPDLVK
KIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDPQTASRSLVLSEDRKSVRYTRQK
KNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDLQLGDGGGCTVGVAGEGVRRKGEMGLSA
EDGVWAVIISHQQCWASTSPGTDLPLSEIPRYVGVALDYEAGQVTLLNAQTQEPIFTFAA
SFSGKVFPFFAVWKKGSCLTLKG
Download sequence
Identical sequences ENSMMUP00000003862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]