SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003884 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003884
Domain Number 1 Region: 90-169
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000112
Further Details:      
 
Domain Number 2 Region: 185-277
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.87e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000128
Further Details:      
 
Domain Number 3 Region: 379-470
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000148
Further Details:      
 
Domain Number 4 Region: 278-369
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003884   Gene: ENSMMUG00000002899   Transcript: ENSMMUT00000004117
Sequence length 644
Comment pep:known chromosome:MMUL_1:1:80783818:80819032:-1 gene:ENSMMUG00000002899 transcript:ENSMMUT00000004117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGG
EQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHG
DGPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGD
PYKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKK
IQNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRG
RGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNA
DPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTP
MGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAY
YAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAP
TGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ
Download sequence
Identical sequences A0A0D9S6X7 A0A1D5QLH1 A0A2I2Y888 A0A2J8WQ94 A0A2K5NN92 A0A2K6EBC5 A0A2K6MTH8 A0A2K6RIH0 K7BSY0 Q96AE4
ENSP00000359804 9606.ENSP00000359804 gi|17402900|ref|NP_003893.2| NP_003893.2.87134 NP_003893.2.92137 XP_004026060.1.27298 XP_005543007.1.63531 XP_007976415.1.81039 XP_010378963.1.97406 XP_011741236.1.29376 XP_011852766.1.47321 XP_011937521.1.92194 XP_014998619.1.72884 XP_017732884.1.44346 XP_513511.3.37143 ENSP00000359804 ENSMMUP00000003884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]