SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003905 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003905
Domain Number 1 Region: 75-355
Classification Level Classification E-value
Superfamily L domain-like 1.02e-50
Family Ngr ectodomain-like 0.002
Further Details:      
 
Domain Number 2 Region: 31-94
Classification Level Classification E-value
Superfamily L domain-like 0.00000918
Family Ngr ectodomain-like 0.0085
Further Details:      
 
Domain Number 3 Region: 411-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000515
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003905   Gene: ENSMMUG00000002916   Transcript: ENSMMUT00000004138
Sequence length 649
Comment pep:known chromosome:MMUL_1:10:47638186:47643437:-1 gene:ENSMMUG00000002916 transcript:ENSMMUT00000004138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPAWSIFLIGTKIGLFLQVAPLSVMAKSCPSVCRCDAGFIYCNDRFLTSIPTGIPEDA
TTLYLQNNQINNAGIPSDLKNLLKVERIYLYHNSLDEFPTNLPKYVKELHLQENNIRTIT
YDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPWGLPRTIEEL
RLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAA
PVNLPGTNLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQL
ILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFDCKDSGI
VSTIQITTAIPNTVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTGSPSRKTITITVKSVTS
DTIHISWKLALPMTALRLSWLKLGHSPAFGSITETIVTGERSEYLVTALEPDSPYKVCMV
PMETSNLYLFDETPVCIETETAPLRMYNPTTTLNREQEKEPYKNPNLPLAAIIGGAVALV
TIALLALVCWYVHRNGSLFSRNCAYSKGRRRKDDYAEAGTKKDNSILEIRETSFQMLPIS
NEPISKEEFVIHTIFPPNGMNLYKNNHSESSSNRSYRDSGIPDSDHSHS
Download sequence
Identical sequences A0A096MYT7 A0A0D9SBF4 A0A2J8VD74 A0A2K5L1A1 A0A2K5XWH9 A0A2K6JV57 F6SUY7 G7PH00
ENSMMUP00000003905 ENSMMUP00000037477 ENSPANP00000005108 NP_001252801.1.72884 XP_005568372.1.63531 XP_005568373.1.63531 XP_007958699.1.81039 XP_007958702.1.81039 XP_007958707.1.81039 XP_010371552.1.97406 XP_010371553.1.97406 XP_010371554.1.97406 XP_011850594.1.47321 XP_011850595.1.47321 XP_011907430.1.92194 XP_011907431.1.92194 XP_011907432.1.92194 XP_015004830.1.72884 XP_015004831.1.72884 XP_015285576.1.63531 XP_017704825.1.44346 XP_017704826.1.44346 9544.ENSMMUP00000003905 ENSMMUP00000003905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]