SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003914 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003914
Domain Number 1 Region: 34-98
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 141-222
Classification Level Classification E-value
Superfamily EF-hand 0.000000000032
Family S100 proteins 0.085
Further Details:      
 
Domain Number 3 Region: 228-269
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000262
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003914   Gene: ENSMMUG00000002925   Transcript: ENSMMUT00000004149
Sequence length 308
Comment pep:known chromosome:MMUL_1:2:40446265:40498500:-1 gene:ENSMMUG00000002925 transcript:ENSMMUT00000004149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKP
HKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDE
LRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAIN
ITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETY
ADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
KRVSTKEI
Download sequence
Identical sequences A0A096MTK1 A0A1D5Q5V4 A0A2K5NT37 A0A2K5U4N2 Q12841
ENSPANP00000003135 ENSP00000295633 NP_001231516.1.72884 NP_009016.1.87134 NP_009016.1.92137 XP_005548104.1.63531 XP_011923845.1.92194 ENSP00000295633 ENSMMUP00000003914 ENSMMUP00000003914 ENSP00000295633 9544.ENSMMUP00000003914 9606.ENSP00000295633 gi|5901956|ref|NP_009016.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]