SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003955 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003955
Domain Number 1 Region: 347-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 2 Region: 986-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 3 Region: 831-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 783-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 7 Region: 522-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 283-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 9 Region: 470-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 10 Region: 435-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 11 Region: 1038-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 12 Region: 1143-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1095-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003955
Domain Number - Region: 1580-1782
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003955   Gene: ENSMMUG00000002952   Transcript: ENSMMUT00000004192
Sequence length 1798
Comment pep:known chromosome:MMUL_1:2:87318692:87330962:1 gene:ENSMMUG00000002952 transcript:ENSMMUT00000004192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLREGQALEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTLQRPGPVPAHSLCGHVLPK
DDRIQGTLQPHTRYMVFPNPVCLEPAISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRALVLEMFSGGNAAALERRATFERYQCHEEGLVPSKTSPSEACAPLLLSLSTLIYNGA
LSCQCNRQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSPEGALS
SLCEKTSGQCPCRTGTFGLHCDRCQRGQWGFPSCRPCVCNGHADECDTHTGACLGCRDHT
GGEHCERCIAGFHGDPQLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQKIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDLMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDRSSGQCPCLPNVQGPSCDHCA
PNFWNFTSGHGCHPCACHPRQARGPTCNEFTGQCYCRAGFGGRTCSECQELHWGDAGLQC
RACDCDPRGTDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGFFPACHPCHACFGDWDRV
VQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERCANTSALAVPSPVSNSASARHRTEALMDAQNEDFN
SKHMANQRALRKLSAHTHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
NCNGAVATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELVQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGV
AQGAIRGAVADTRDTEQTLYQVQERMTGAEQALRSAGERARQLDALLEALKLKWAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQGRAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences I0FRM8
ENSMMUP00000003955 NP_001181397.1.72884 XP_014986301.1.72884 ENSMMUP00000003955 9544.ENSMMUP00000003955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]