SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000003986 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000003986
Domain Number 1 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 4-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-18
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 360-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000236
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 262-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000172
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 307-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000974
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000003986
Domain Number - Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00357
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000003986   Gene: ENSMMUG00000002988   Transcript: ENSMMUT00000004225
Sequence length 579
Comment pep:novel chromosome:MMUL_1:10:18019962:18026464:1 gene:ENSMMUG00000002988 transcript:ENSMMUT00000004225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLLQGSVLFEDVSVDFTQKEWQLLNPAQRLLYRDVMLENYRHLVSMAGHCVTKPELIVK
LKQGEESWILKREPPSQSHSGEPGVCFLTEKRNQREIKHHSVWTLFFHINNKILTKRSKT
LREAFNMATNTVPSRKMSHKCDSFGTSLKSVSEIIINDINHVRKKVRCDFLYIKHNKTHA
ENKPCENDQKKKSPDFVQHPKDSSLEQLLEYNNRGKGFHRKIVFVTCKRALMVEKPSERN
KYGQVLSQRSYTILKMRELVQGRKIYQCKKCGKFFHEKACLTQHKRAHTTGKPSKCNDSE
RVLKKESCLTPNQIIKTREKNCKGNKCEKPFFEKLKHTQHQRRHSGKKTNGCNESGGASS
RKSQLTQSQRAHTEKTCDCNKCGESFHKKTDLRQHQSTHRGEKKKTYECNECEKSFFVKS
NYSEHQRTHTGEKPYKCNECGNSFCQKSAFSVHQRIHTRAKPYKSNECGKTFCVKSNLTQ
HQRTHTGEKPYKCNECWRSFCVKSNLVVHQRTHTGEKPYRCPECGKTFYEKSALTKYELN
HTGENPYECNKCRKTFSQRSSLTKHQRKIHKKKTPINTL
Download sequence
Identical sequences ENSMMUP00000003986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]