SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004148 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004148
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-56
Family Eukaryotic proteases 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004148   Gene: ENSMMUG00000003108   Transcript: ENSMMUT00000004398
Sequence length 232
Comment pep:known_by_projection chromosome:MMUL_1:20:1201037:1203763:1 gene:ENSMMUG00000003108 transcript:ENSMMUT00000004398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNLLLLALPVLVSPAHAAPAPGQALQRVGIVGGQEPRSKWPWQVSLRLHGQYWMHFCGG
SLIHPQWVLTAAHCVGPDVKDLADLRVQLREQHLYYQDQLLPVSRIIVHPQFYAVQIGAD
IALLELEEPVNVSSHVHTVTLPPASETFPPGTPCWVTGWGDVDNDVRLPPPYPLKEVEVP
IVENQLCDAEYHTGLHTGDSFRIVRDDMLCAGSEKHDSCQVATAPHTFPHPE
Download sequence
Identical sequences ENSMMUP00000004148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]