SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004158 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004158
Domain Number 1 Region: 39-150
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-27
Family PDZ domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000004158
Domain Number - Region: 1-28
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00421
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004158   Gene: ENSMMUG00000032066   Transcript: ENSMMUT00000004408
Sequence length 171
Comment pep:novel chromosome:MMUL_1:1:64591328:64601298:1 gene:ENSMMUG00000032066 transcript:ENSMMUT00000004408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSLFET
YNVELVKKDGQSLGIRIVGYIGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVAVNG
VNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSSSTSPLEPLSARGRAVQFW
Download sequence
Identical sequences ENSMMUP00000004158 9544.ENSMMUP00000004158 ENSMMUP00000004158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]