SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004209 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004209
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-19
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 2 Region: 309-350
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000923
Family LIM domain 0.018
Further Details:      
 
Domain Number 3 Region: 279-307
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000499
Family LIM domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004209   Gene: ENSMMUG00000003146   Transcript: ENSMMUT00000004460
Sequence length 351
Comment pep:known chromosome:MMUL_1:6:174018655:174027213:-1 gene:ENSMMUG00000003146 transcript:ENSMMUT00000004460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKAVAPCRAPPWGGLSPRHSVPPCPRLFT
PPHLSSSPPHPPHRQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFM
QDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTTPSPTSRPPWAVDPAFAERYAPDKT
STVLTRHSQPATPTPLQNRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGH
AYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG
Download sequence
Identical sequences 9544.ENSMMUP00000004209 ENSMMUP00000004209 ENSMMUP00000004209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]