SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004216 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004216
Domain Number 1 Region: 39-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000202
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004216   Gene: ENSMMUG00000003153   Transcript: ENSMMUT00000004467
Sequence length 318
Comment pep:novel scaffold:MMUL_1:1099553000124:4755:30303:1 gene:ENSMMUG00000003153 transcript:ENSMMUT00000004467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAAFCPQCPKYAKCHNSTHCTCEHGFSARSGRTYFHEFSEKCEDINECETGLAKCKYEAH
CKNKIGTYICSCWVKHPVLNWLAGFIDYNFPDCYEDDSQGTQAKVDIWVSGVKPGFGKQL
PGDERTKHICVYWEGLEGGSWSTEGCSRVCSNGSYTKCKCFHLSSFAVLVALAPKEDPVL
TVITQVGLAISLLCLFLAILTFLLCRPIQNTSTSLHLQFSLCLFLAHLLFLTGINRTEPE
VLCSLIAGLLHFLYLACFTWMLLEGLHLFLTVRNLRVANYTSMGRFKKRFMYPVGYGIPA
VIIAVSAIVGPQNYGTFT
Download sequence
Identical sequences ENSMMUP00000004216 ENSMMUP00000004216 9544.ENSMMUP00000004216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]