SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004252 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004252
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily Cyclophilin-like 5.7e-76
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000004252   Gene: ENSMMUG00000003189   Transcript: ENSMMUT00000004510
Sequence length 207
Comment pep:known chromosome:MMUL_1:9:57717493:57725136:-1 gene:ENSMMUG00000003189 transcript:ENSMMUT00000004510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALRCGPRWLGLLSVPRSVPLRLPAARACSKGAGDPSSSSSSGNPLVYLDVGADGQPLG
RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSI
YGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDV
VKKIESFGSKSGKTSKKIVITDCGQLS
Download sequence
Identical sequences A0A096P4H0 A0A0D9RAD8 A0A2K5WUK7 A0A2K6BAX8 I0FMN3
ENSMMUP00000004252 ENSMMUP00000004252 9544.ENSMMUP00000004252 NP_001253053.1.72884 XP_005565384.1.63531 XP_011712919.1.29376 ENSPANP00000020245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]